Search results

Filter

Filetype

Your search for "*" yielded 552148 hits

Effect of recombinant neutral endopeptidase (EC 3.4.24.11) on neuropeptide-mediated nasal fluid secretion and plasma exudation in the rat

The nasal mucosa harbors sensory nerves containing neuropeptides such as substance P (SP), which are released by capsaicin. The neuropeptides are degraded by peptidases, e.g., neutral endopeptidase (NEP) that is present in the nasal mucosa. We studied the effect of enzymatically active recombinant NEP (rNEP) on neuropeptide-evoked secretion of nasal fluid and plasma exudation in rats. rNEP adminis

Young, Mobile, and Highly Educated Cyclists: How Urban Planning and Policy Dis/able Users

The focus of this study is how intended users of the built environment are categorized in strategies, policies, and guidelines for the planning and building process. The image of the intended user reflects a disabling society that also is in conflict with established policies on a society for all. Patterns of inequality are found in the materials, both within and across groups of users. With youth

Element-specific investigations of ultrafast dynamics in photoexcited Cu2ZnSnS4 nanoparticles in solution

Ultrafast, light-induced dynamics in copper-zinc-tin-sulfide (CZTS) photovoltaic nanoparticles are investigated through a combination of optical and x-ray transient absorption spectroscopy. Laser-pump, x-ray-probe spectroscopy on a colloidal CZTS nanoparticle ink yields element-specificity, which reveals a rapid photo-induced shift of electron density away from Cu-sites, affecting the molecular or

Heterogeneous contributions of change in population distribution of body mass index to change in obesity and underweight

From 1985 to 2016, the prevalence of underweight decreased, and that of obesity and severe obesity increased, in most regions, with significant variation in the magnitude of these changes across regions. We investigated how much change in mean body mass index (BMI) explains changes in the prevalence of underweight, obesity, and severe obesity in different regions using data from 2896 population-ba

British Romanticism and Denmark

Traces a multifaceted discourse about Denmark in British eighteenth-century and Romantic-period cultureOffers original perspectives on British, Danish, and European Romanticism, and the relationship between themContributes to the scholarly discussion of Romantic nationalism and the emergence of the idea of ‘regional’ cultural identities in the early nineteenth centuryAddresses a wide range of Nord

Impact of arginine−phosphate interactions on the reentrant condensation of disordered proteins

Re-entrant condensation results in the formation of a condensed protein regime between two critical ion concentrations. The process is driven by neutralization and inversion of the protein charge by oppositely charged ions. Re-entrant condensation of cationic proteins by the polyvalent anions, pyrophosphate and tripolyphosphate, has previously been observed, but not for citrate, which has similar

Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combinat

In-Cycle Closed-Loop Combustion Controllability with Pilot-Main Injections

In-cycle closed-loop combustion control has been proved to reduce cycle-to-cycle variations on emissions and indicated thermal efficiency. In this paper, the in-cycle closed-loop combustion con-trollability achieved by a pilot-main fuel injection scheme is investigated. The controllability is studied by means of the maximum reachable indicated thermal efficiency (MRE). A combustion model is used f

“Suddenly we have hope that there is a future” : two families’ narratives when a child with spinal muscular atrophy receives a new drug

Purpose: This study aims to explore negotiations of hope in everyday life for families where a child with spinal muscular atrophy (SMA) has received a new drug treatment. Methods: A narrative design was used, drawing on interviews and participant observations in two families with children with SMA, types 1–2, to situate family experiences of hope in everyday life. Narrative analysis was used on th

Gravitoviscous protoplanetary disks with a dust component : II. Spatial distribution and growth of dust in a clumpy disk

Aims. Spatial distribution and growth of dust in a clumpy protoplanetary disk subject to vigorous gravitational instability and fragmentation is studied numerically with sub-au resolution using the FEOSAD code. Methods. Hydrodynamics equations describing the evolution of self-gravitating and viscous protoplanetary disks in the thin-disk limit were modified to include a dust component consisting of

Quasi-static contraction during runaway gas accretion onto giant planets

Gas-giant planets, like Jupiter and Saturn, acquire massive gaseous envelopes during the approximately 3 Myr-long lifetimes of protoplanetary discs. In the core accretion scenario, the formation of a solid core of around ten Earth masses triggers a phase of rapid gas accretion. Previous 3D grid-based hydrodynamical simulations found that runaway gas accretion rates correspond to approximately 10 t

Cylinder Pressure Based Method for In-Cycle Pilot Misre Detection

For the reduction of emissions and combustion noise in an internal combustion diesel engine, multiple injections are normally used. A pilot injection reduces the ignition delay of the main injection and hence the combustion noise. However, normal variations of the operating conditions, component tolerances, and aging may result in the lack of combustion i.e. pilot misfire. The result is a lower in

Compton-thick active galactic nuclei from the 7 Ms observation in the Chandra Deep Field South

We present the X-ray spectroscopic study of the Compton-thick (CT) active galactic nuclei (AGN) population within the Chandra Deep Field South (CDF-S) by using the deepest X-ray observation to date, the Chandra 7 Ms observation of the CDF-S. We combined an optimized version of our automated selection technique and a Bayesian Monte Carlo Markov chains (MCMC) spectral fitting procedure, to develop a

Sweden: Non-binding Rules against the Pandemic – Formalism, Pragmatism and Some Legal Realism

Swedish measures to fight the spread of COVID-19 differ from the strategies used in other comparable countries. In contrast to the lockdown approach that has been applied in many European countries, the Swedish strategy has been based to a substantial extent on individuals taking responsibility under non-binding recommendations. This contribution explores the Swedish strategy from a constitutional

Stochastic Set-Point Optimization for In-Cycle Closed-Loop Combustion Control Operation

The constrained indicated efficiency optimization of the set-point reference for in-cycle closed-loop combustion regulators is investigated in this article. Closed-loop combustion control is able to reduce the stochastic cyclic variations of the combustion by the adjustment of multiple-injections, a pilot and main injection in this work. The set-point is determined by the demand on engine load, bu

Primary care physicians’ knowledge, attitudes and concerns about bariatric surgery and the association with referral patterns : a Swedish survey study

Background: Obesity prevalence is increasing globally. Bariatric surgery is an effective treatment for severe and complex obesity resulting in significant and sustained weight loss. In Sweden, most bariatric surgery patients are referred by primary care physicians. We aimed to explore barriers for physicians to refer patients with severe and complex obesity for bariatric surgery. Methods: A questi

In Search of Search (& its Engines)

Research notes & miscellany from a research group focused on the intersection between media & information literacies and search, search engines, and search-adjacent recommender systems. Based at Lund University’s Pufendorf Institute for Advanced Studies.